DPCstruct | MC4645
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 334 ± 48 aa |
| Standard deviation of domain lengths | 47.89 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 65.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.18 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7K3M8 | 13-269 | IDYLADNIRTVMLESRQNKLRKHYQPVQHSAQRIAQNYSTSTFNSTELAKDIIRQNLDKDTLYTYNENYHHSATFVPVNVEELKKQE… |
| A0A2C9L5S2 | 3-267 | PAYNYSIQHLNSTELAKNKLRQLLNEEHPRARYAYNSEFLSGMLTPVDLQQDKKDKEEANRSLWRTEKGWVYPGMRSLQESNTPLKQ… |
| H2YY79 | 2-288 | None |
| A0A6I9NHJ6 | 38-396 | None |
| A0A7S3JE28 | 132-475 | None |
| A0A7S3KUT2 | 353-686 | None |
| A0A2G8JD18 | 1-418 | None |
| A0A7S2CUU3 | 2-379 | None |
| A0A4D9EVS4 | 1-348 | None |
| A0A7S1U4M0 | 430-774 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.