DPCstruct | MC46446
Metacluster Properties and Pfam Annotations
| Number of structural domains | 141 |
|---|---|
| Mean domain length (aa) | 226 ± 60 aa |
| Standard deviation of domain lengths | 60.48 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 86.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 23.78 |
| Pfam Score | 87.88 |
| Assigned Pfam label(s) | PF00557- CL0105- CL0303- PF14374- PF00573 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A836DA99 | 36-253 | SEKAGHQTSAESWGTGRAVARIPRVGGGGTHRSGQAAFGNMCRGGRMFAPTKIWRKWHVKVNQNQRRFAVVSALALLPSLLSSLLVA… |
| A4H6Q8 | 69-334 | RIVAPVFDLANKVSHTRELDPFIFGLYPETEEMAKNLSYWLVRCQNFSSKWDYENREIWRKAKKNWPNTGMGMARVGDRKNHAHPWG… |
| A9T3B9 | 49-263 | None |
| A0A0D8Y2L3 | 584-808 | None |
| A0A0N4WB61 | 549-791 | None |
| I2H4P9 | 38-231 | None |
| A0A7R9W9Q3 | 1-140 | None |
| A0A0G4MFR5 | 239-478 | None |
| A0A830CMR5 | 772-990 | None |
| A0A7Z1LGV0 | 5-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.