DPCstruct | MC46432
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 233 ± 33 aa |
| Standard deviation of domain lengths | 33.15 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 51.05 |
| Pfam Score | 84.62 |
| Assigned Pfam label(s) | PF11001- PF04873 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G2ZIY1 | 7-261 | YKKEKEDEEEDISYDELKKRMWKDRMRLQKLKEKGLEEEIDANSKSQTKAKQQQYLCQRKKMSKAQNSILKYMVKAVYGIVSEKGKL… |
| A0A833R4V2 | 6-218 | QVRRKQIYLINDKILKCMLHIMESSNARGFVYGMVPENGKPLTGASDSLRRWWKEHAMFDKKAPAEVDPFYAENALMSSVSQRNEPM… |
| A0A7J8NCD7 | 1-214 | None |
| A0A6A4P8I0 | 1-195 | None |
| A0A833RK79 | 2-205 | None |
| A9SK60 | 1-240 | None |
| A0A438JVH8 | 2-152 | None |
| A0A453I6J0 | 4-195 | None |
| A0A2P5X9I7 | 2-239 | None |
| A0A0K9QM86 | 42-308 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.