DPCstruct | MC46431
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 96 ± 7 aa |
| Standard deviation of domain lengths | 7.39 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A443N3Q1 | 3-95 | FSSMPTSPDCVVFAILNHIPFDNILINTYSPGAQSRHSYIRWKGVSPLFSSSTNPIFYNGLFYCLGLQGNLGVYNVSENTWNVLKER… |
| A0A6A2YAW9 | 366-450 | TFLVATFALNATSPKCTIFLLWSKYGKIYIKLCSAGDCSWKTFEFDGFDWPNPAVDAAYANGVFYCVFRGGQLGAFDVEHTEWTI |
| A0A2N9GTL3 | 606-694 | None |
| A0A803L2V2 | 529-630 | None |
| D7LYR5 | 1-98 | None |
| A0A811PAV8 | 74-175 | None |
| A0A6A6M1R8 | 452-545 | None |
| A0A6D2HQP4 | 483-599 | None |
| A0A0D9X356 | 453-549 | None |
| A0A1U8JP47 | 48-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.