DPCstruct | MC46428
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 168 ± 35 aa |
| Standard deviation of domain lengths | 35.14 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 76.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 34.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08698 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0V1PQB3 | 1-106 | MKQPELTPSITRDLSIIKQRNALDPKRHYKKDKWEIPKFFQMGTVVEGNTEFYSARMSRRERGNTLVEEVLNDSDRKKYFKRKYTEI… |
| A0A3S3Q9K1 | 20-187 | ICSGTKGSSEKLQSLTVDTGLKHDCGLVDGLFVPPREPRKLNKLLRKQVKDTTGKSWFDMPAPTVTPEMKKDLQIIKLRSVIDPKRH… |
| A0A4Q4YBI4 | 32-202 | None |
| A0A4S4CY11 | 24-157 | None |
| A0A1C3L3M4 | 9-180 | None |
| A0A1I8D0Z2 | 14-179 | None |
| A0A0C2M4J2 | 6-131 | None |
| A0A0K0DX09 | 21-141 | None |
| H2YPK3 | 117-329 | None |
| A0A3R7PCY0 | 212-412 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.