DPCstruct | MC46423
Metacluster Properties and Pfam Annotations
| Number of structural domains | 198 |
|---|---|
| Mean domain length (aa) | 184 ± 27 aa |
| Standard deviation of domain lengths | 27.36 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 16.77 |
| Pfam Score | 76.34 |
| Assigned Pfam label(s) | PF05076- PF12470- PF11979 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D4IUU6 | 14-152 | EHWHYVSFGLSDLYGDNRVHEFTGSDGPSGFGFELTFRLKRETGESAPPTWPAELMQGLARYVFQSENTFCSGDHVSWHSPLDNSES… |
| A0A419HZF4 | 10-185 | FLDHVKGYLGPVRETESATTSGVNRGYALFFCAADESGLISVVTNGLRYQPISSRLPQELVCTLRHDQRQAAHHIASATAQVIIEFK… |
| A0A7S0AMG2 | 6-180 | None |
| A0A430A7D0 | 40-240 | None |
| A0A3M1T3Q1 | 211-421 | None |
| Q08QE5 | 293-456 | None |
| A0A7J9Z3V3 | 167-363 | None |
| A0A7W4EY59 | 75-285 | None |
| L0DB90 | 121-316 | None |
| A0A7J9Z6J5 | 16-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.