DPCstruct | MC4642
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 178 ± 9 aa |
| Standard deviation of domain lengths | 9.35 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 92.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 33.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0094 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C9L3H5 | 3-186 | HESSNFGLHLAMGLANVWNHEGDPITALQVGQIVQNFKESLKKNPKLLQQKVKEYLKDNKHKLTLIMQPDESYMEKNDLAEKERLNK… |
| A0A7J9FC25 | 162-340 | GLSLMLRSMGKWIYDMDPFEPLKYEQPLLDLKARIAEEGSKAVFSPLIEKFILNNPHCVTIEMQPDPEKASRDEAAEKENLEKVKAS… |
| A0A1Y3AXA0 | 26-214 | None |
| A0A813N5S7 | 62-243 | None |
| A0A814JZ42 | 599-780 | None |
| A0A6I1J337 | 1-165 | None |
| A0A7J7L8Y4 | 514-673 | None |
| A0A182T7Q2 | 1-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.