DPCstruct | MC46414
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 118 ± 10 aa |
| Standard deviation of domain lengths | 10.32 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 93.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 26.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T6C6F1 | 4-106 | TLVNKYNQKRAELEPVIRHAINFESKNYAPQTIYIANELDDNVINIFRASQFIEFKDTTSNMRHVYGVNIFAFTTNEIIRILDSDIT… |
| R9LKP6 | 83-205 | LTEVTMSTSSRQEAMEGEPVRRHVSDAVLKYDKPVYGMFIAVRIDTNTAETFRHGIWYAKGDVKQRLDIVPLTLGQFQKYFTAMFEA… |
| A0A376CMN8 | 249-374 | None |
| A0A532UU41 | 89-216 | None |
| A0A8A6PKI6 | 197-318 | None |
| K0JGU1 | 5-109 | None |
| A0A099TZ21 | 496-623 | None |
| A0A0R2LPD5 | 79-202 | None |
| I0ESV1 | 1-111 | None |
| A0A410PQZ3 | 21-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.