DPCstruct | MC4641
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 86 ± 8 aa |
| Standard deviation of domain lengths | 7.65 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 30.86 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | CL0105- PF07687 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8HAG0 | 524-604 | NLWLFKPLVSYRNPPTNALIRTTTAVTMFNAGIKHNVLASSAQAVVNHRIHPSQTIQQVVDHDRQVIADPRIQIEILDGIE |
| A0A0D2J7F4 | 52-135 | VVARFMASSGAQGAALTRTTAAVTGVTAGVADNVLPQQGTININTRLLPGDTPQDVLTYLTSVIGPKDMARVTLELGPPGTSQP |
| A0A820EIZ5 | 1-81 | None |
| A0A812QUR9 | 253-325 | None |
| A0A2V8DUZ6 | 72-156 | None |
| A0A7R8ZHM4 | 809-900 | None |
| R7BUM8 | 30-123 | None |
| A0A645E8Z2 | 32-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.