DPCstruct | MC46405
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 71 ± 4 aa |
| Standard deviation of domain lengths | 4.28 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 58.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B8Q216 | 1-65 | MYGRGGYGWKFTNPDGSVFYHGGGGVHKGSYYGFSNGKTKKVKVYKKEDGYVPTIDDKGTTIQID |
| A0A477KXZ3 | 1-75 | MLGEGWKEETYGSAGNGWKFTNEGDGMVFYHPGEGIHKGSYYGFSSGDTGKVKIVGKDYIDFSKDKATIIKFGGE |
| A0A829R4L4 | 268-342 | None |
| A0A1V4SGD1 | 267-338 | None |
| A0A1V4SF82 | 723-792 | None |
| A0A2T5RX88 | 240-310 | None |
| A0A0Q3HNF1 | 292-366 | None |
| A0A242ANG1 | 91-165 | None |
| A0A1E5HBK5 | 198-259 | None |
| A0A1H9TNP7 | 422-493 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.