DPCstruct | MC46402
Metacluster Properties and Pfam Annotations
| Number of structural domains | 85 |
|---|---|
| Mean domain length (aa) | 114 ± 18 aa |
| Standard deviation of domain lengths | 18.41 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03392 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G9BWI4 | 11-119 | YLAIADERYTTKYDNIDIDAVISTERLLQNYIKCLLDLVVCTEEGSELKKNMPDAIQNDCSKCSDKQKEGSDKLILYLINNKPEYWQ… |
| A0A7G8Z915 | 10-116 | LAGLAIAAERPGENLNIDHVNYVLNNQRLLTNYIKCLLDERPCTGEVRELKKLLPELLKNGCNKCDTSKRAIAEKVVRHLQTKRKQE… |
| A0A226F4F8 | 8-119 | None |
| A0A1B0BQW0 | 36-156 | None |
| A0A1L2BLD4 | 13-129 | None |
| A0A5C0E4B2 | 2-94 | None |
| A0A096W1K5 | 15-149 | None |
| A0A096W1K7 | 2-101 | None |
| A0A096W1K0 | 9-108 | None |
| A0A6L5CV36 | 59-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.