DPCstruct | MC4640
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 123 ± 11 aa |
| Standard deviation of domain lengths | 11.18 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 73.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 45.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A240SWD9 | 191-308 | NIPKMSAKHVQMSFPSVENQNTISVDEILFKPGRLTRPKKICVILRGPPGSGKSHVAKLIKEKEKEMGSGNPRILSVDDYFLIENDY… |
| A0A2C9L1Z2 | 1-107 | TFGRIPSPAPGTPPTSASLTEPETVKIEDILCPPGRLTRPPQIVVIIRGLPGSGKTYISKLIREKETNYGGSAARMLCLDDYFMVES… |
| T1PB19 | 443-562 | None |
| Q8C8U8 | 558-698 | None |
| A0A804PHN5 | 1-142 | None |
| A0A7J0GMR9 | 502-619 | None |
| A0A0K8VSY4 | 20-137 | None |
| A0A1B0D1J9 | 815-929 | None |
| A0A438I151 | 568-696 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.