DPCstruct | MC464
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 231 ± 38 aa |
| Standard deviation of domain lengths | 38.31 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 18.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16130 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N2YWG7 | 371-639 | FINNFPASGNGSLGFEDLWPGTGDYDFNDIVLDYKFVTITNASNKVVQVNGTFIIKASGAYLRNGFGFNLPNANISLISGLNISGYD… |
| A0A3D5VCQ7 | 291-541 | TAFYPAENEFGTLAYEDYWPQQGDYDMNDLVIDYNMSFETSYTRHGGTIFAKFKIRAIGASYTIGFGFQLPYFILVNGNVTSTSGLA… |
| A0A2J6IFL8 | 5-175 | None |
| A0A426H5E8 | 161-370 | None |
| A0A6B2M1I6 | 186-415 | None |
| A0A1H8A6T5 | 217-411 | None |
| A0A1H8BZ63 | 530-734 | None |
| R7DUK5 | 117-373 | None |
| A0A3N2NIM0 | 681-906 | None |
| A0A6I2TTR1 | 482-660 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.