DPCstruct | MC46399
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 80 ± 7 aa |
| Standard deviation of domain lengths | 6.59 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 39.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A2K8J9 | 594-675 | WAEFIRIVDPDILTGYNILNFDLPYILDRAKVLKLPQVALLGRQKDKASGVRDAVLSSKQMGSRVNKSIDIHGRVIFDVLQV |
| A0A183Q6J4 | 1-75 | DPDIITGYNIQNFDLPYLINRANTLKVDGFEFLGRIRGARSTIREAMTQSKQMGRRENKFVNIDGRVQFDLLQVS |
| A0A6P3Z4M8 | 155-237 | None |
| U6KIT2 | 124-191 | None |
| A0A1D6QLU0 | 342-415 | None |
| M7C6R1 | 185-270 | None |
| A0A5K3EUA5 | 401-482 | None |
| A0A453HJ07 | 6-84 | None |
| A0A5K3FT37 | 137-200 | None |
| A0A2J7ZIZ2 | 194-277 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.