DPCstruct | MC46398
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 76 ± 8 aa |
| Standard deviation of domain lengths | 8.10 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 47.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0103 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P5MZ93 | 1-77 | MSKFLVILYVVWLAASGFVNGSIIKKEKDQIRVFELKKGDLTLKVTNWGATLVSLVLPDKYGKLGDILLGYDSPEAY |
| A0A1D6HBB8 | 33-95 | AAAAAWTRKIVGVHELRVGDFSVKVTNWGATLMSVILPDSKGNLGDVVLGYDTVAEYVNGTAY |
| A0A287ILA0 | 5-80 | None |
| A0A287VZF0 | 5-78 | None |
| A0A0A0LPC7 | 1-70 | None |
| A0A3L6GA35 | 1-84 | None |
| A0A1D6E990 | 1-75 | None |
| A0A1R3I9H2 | 10-85 | None |
| A0A835RV16 | 1-80 | None |
| A0A287ILB0 | 1-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.