DPCstruct | MC46396
Metacluster Properties and Pfam Annotations
| Number of structural domains | 109 |
|---|---|
| Mean domain length (aa) | 89 ± 14 aa |
| Standard deviation of domain lengths | 13.82 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 35.08 |
| Pfam Score | 96.23 |
| Assigned Pfam label(s) | CL0063- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P5MMQ9 | 138-222 | ATLHSYVNSEHICGRPLGLRSDKRTGDLYIADAYFGLMKVGPEGGPAISLATEAEGVPLRFTNDVDIDAHGNVYFTDSSSYYQRR |
| A0A2P5AKJ8 | 1-73 | MGIGFYLLTKQLFVADAYQGFLVAGPNGGLATTIASSAEGMPFKLPTGLDVDQSTGNVYFTDASSQYSLSQIQ |
| A0A7J8V0W8 | 22-92 | None |
| A0A388LJ44 | 21-116 | None |
| M4CV79 | 4-86 | None |
| A0A2N9GTB6 | 106-181 | None |
| G7IQK8 | 42-128 | None |
| A0A835J3J8 | 241-320 | None |
| A0A5N5KB83 | 19-102 | None |
| A0A7J9ILA3 | 33-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.