DPCstruct | MC4638
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 116 ± 7 aa |
| Standard deviation of domain lengths | 7.14 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 76.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 40.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0392 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M5UCU3 | 35-147 | NPDKVDEYTEIFREIQGAYDVLSDRQERAFYDKHREAILRGGDEFVDDSVDLMQYFNPGCHTGHNDTPNGFYAVYGKVFTMVAEEEE… |
| A0A2C9L0U6 | 1-117 | KNPDNVEEATAQFRLVQQAYEVLSDPQERAWYDKHREAILRGGLGGGDKYDDESLDLFQYFNSTCYSGFGDDDKGFYAVYRKVFETL… |
| A0A818AX26 | 464-576 | None |
| A0A1I8H8V6 | 675-789 | None |
| A0A443RQ14 | 7-112 | None |
| C1MWB6 | 40-154 | None |
| A0A7J6SBQ2 | 40-154 | None |
| A0A167MLU3 | 54-190 | None |
| A0A1I8IUS1 | 398-512 | None |
| A0A1I8CHW2 | 7-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.