DPCstruct | MC46379
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 195 ± 27 aa |
| Standard deviation of domain lengths | 26.99 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 68.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 27.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A401H064 | 185-394 | LSQVSPLVQIFARSASPVRASRTKATNATNATTALSQEQDAEGEGDASESQDEYVPSRPSRARPPRPAPARRQGPRTRRYAPYARAV… |
| A0A0C2YQM8 | 1-220 | MDRMTPEKRALVEQQNPVSRRRFSAVKTLSTHSRTYIRPPTPNSSSDEDADGDSDDEYIPSPVLSSNKRLRSESVEVKSEFSSIAIP… |
| A0A5C2T3C7 | 151-354 | None |
| A0A1Y2IJ25 | 73-254 | None |
| A0A4Y9Z4C5 | 79-331 | None |
| A0A4Y9Z2F9 | 253-470 | None |
| F8PZP1 | 15-169 | None |
| A0A4Q9M3D8 | 99-279 | None |
| A0A5K1JV85 | 135-300 | None |
| A0A401GRW4 | 405-571 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.