DPCstruct | MC4637
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 173 ± 35 aa |
| Standard deviation of domain lengths | 34.96 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 69.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 18.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02582 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B0D2B8 | 1-134 | MFSSSVSLRKKRPEEAEVSEDGHFTVTAYATAEEYDLEKLLSGLVQQELYQPKKFICTDDNGVEPDVLYVSAKYQVDKEPRDIFFFR… |
| A0A2C9L006 | 79-244 | LKRRSLICCLTHSCQQRFYTNSPQHRYSTKIESSALLQDHSALQVRRQTRKKIPKTTDENETLQKDNVVAYAVAEEIDLKSLEIFLV… |
| A0A183J8E3 | 18-156 | None |
| A0A3Q0J5G2 | 16-186 | None |
| A0A5S6QEM8 | 38-166 | None |
| A0A7R9LFN1 | 16-171 | None |
| K3XAM1 | 438-715 | None |
| A0A498NQ63 | 1-149 | None |
| A0A317XW11 | 143-343 | None |
| A0A4Z0ABC2 | 1-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.