DPCstruct | MC46366
Metacluster Properties and Pfam Annotations
| Number of structural domains | 361 |
|---|---|
| Mean domain length (aa) | 179 ± 33 aa |
| Standard deviation of domain lengths | 33.11 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 15.04 |
| Pfam Score | 59.83 |
| Assigned Pfam label(s) | CL0023- CL0199- CL0402- PF12257- PF06807 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L9PCR7 | 2-166 | NSVIDAVNQDNSVITLSANTMEVLQLQSGDTVLVKESRDKTTALIVISDNKMEDGYACVNHVVRNNLGIKHGDIVRVYPCDDIKYAK… |
| A0A0N4VL56 | 28-194 | KPNRLMVDQSSNDDNSVVGLSQAKMDELGLFRGDAILLKGKKRKETVCVALPDESCSNEKIKMNRVVRNNLRVRLGDIISVNPATDL… |
| A0A6S7GG59 | 15-212 | None |
| A0A819PKZ0 | 406-566 | None |
| A0A819PJZ7 | 4-207 | None |
| A0A2H3GAE4 | 1-197 | None |
| A0A6B0GSG8 | 158-333 | None |
| A0A2J2H6L5 | 192-374 | None |
| A0A1D2NCF7 | 24-299 | None |
| A0A7S4RDF2 | 10-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.