DPCstruct | MC46361
Metacluster Properties and Pfam Annotations
| Number of structural domains | 518 |
|---|---|
| Mean domain length (aa) | 168 ± 30 aa |
| Standard deviation of domain lengths | 30.27 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 15.76 |
| Pfam Score | 93.33 |
| Assigned Pfam label(s) | CL0101- CL0258- CL0063- CL0098- CL0178 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A380LK65 | 46-236 | GAFLAKPLQKPYLYITDEIEVPATLHHITLCCALIKQDRFEVMLQKACELGVSRIVPFDSRFSIVRLDEKKKEKKYERWQQIILDAC… |
| A8ABJ8 | 3-156 | VYVLRIGHRPDRDKRITTHVGLVARAFGAHGFVLSPCDEKVLEKLRDVEERWGRLLEEIACTNSPLKYVKTWDGTVVHLTMYGLPVD… |
| A0A0G4HL68 | 21-234 | None |
| A0A1S8VIH4 | 531-698 | None |
| A0A1J5TLR3 | 3-171 | None |
| A0A6A6L498 | 57-297 | None |
| A0A6A6LDA1 | 397-552 | None |
| M1VMU1 | 122-318 | None |
| A0A812IN01 | 1-148 | None |
| A0A6G3VDP8 | 22-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.