DPCstruct | MC4636
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 234 ± 29 aa |
| Standard deviation of domain lengths | 28.88 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 24.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813L5T6 | 4-167 | QESNLEKVELLRPEVLWIRDCGIRVRRQSEEDLKTGVRQGNQIALSVALQVFFNLQSLWPQLKKVSAELLEEFAQAPLPAGACFHQG… |
| A0A2C9KZQ6 | 1-256 | YICQGVDLSGVEIIDQDRRLVKQARKEVETQAQKMLEQGMATQNQTAVATSLQVFYNLGSLHTVVDRVVAGCRATLHQQVRACLDVQ… |
| A0A7I8VVL3 | 98-335 | None |
| R9PLV4 | 21-292 | None |
| A0A183J770 | 5-243 | None |
| A0A1I8GMW3 | 2-196 | None |
| A0A804KK63 | 1-251 | None |
| A0A0S4JUU7 | 121-346 | None |
| A0A401NL54 | 16-264 | None |
| A0A699ZE80 | 3-242 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.