DPCstruct | MC46359
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 107 ± 12 aa |
| Standard deviation of domain lengths | 11.84 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 93.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 41.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0254 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G3V3R8 | 1-121 | KPSIICLRTIIGYPAPTKMNTGAAHGSALGDDEVAETKKILGFDPEKNFDVSDEVINHTRALLERGTAAKAEWSKGFDAWASANPET… |
| A0A855HX05 | 1-127 | ETSKPTIIICKTIIGLGSPNKQGKEDSHGAPLGADEIKLTREVLGWEDEAFVIPTDIYEHWDAKAKGQQVESAWDKVFAAYQEKYPT… |
| A0A380FG39 | 103-222 | None |
| A0A218X7A1 | 139-245 | None |
| A0A438DIE9 | 276-367 | None |
| A0A376U607 | 66-191 | None |
| A0A1H0QXR3 | 76-171 | None |
| A0A090NL85 | 72-174 | None |
| A0A834LQT1 | 73-164 | None |
| A0A427A956 | 76-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.