DPCstruct | MC46351
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 173 ± 17 aa |
| Standard deviation of domain lengths | 16.68 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 21.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1P8KB40 | 274-443 | SAPWGVDIAQDGILDYVYAGDVNGNMWRFDLTADVAADFKVATNAGGIAVPIFKAPAGQPITMRPASLGVASSTGTGIGNMVLFGTG… |
| A0A132HCI2 | 96-250 | GMTRAIPSDVTPLDRNGDGYVERVYVGDVGGNVWRADFETAASNAPTAWTVTKLAALGGGAGTNDARKFFYPPDVVSTNGYDAISLG… |
| X0QUX8 | 116-279 | None |
| X0QM45 | 1-216 | None |
| A0A6A0ICQ8 | 440-630 | None |
| A0A845BUW4 | 302-452 | None |
| A0A317CTP6 | 659-819 | None |
| A0A4Y3J185 | 737-909 | None |
| A0A496JRF7 | 1018-1184 | None |
| A0A1F4BB23 | 783-956 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.