DPCstruct | MC4635
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 232 ± 28 aa |
| Standard deviation of domain lengths | 27.89 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 68.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 24.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A151NV49 | 1-230 | MGAPACPANFYPLQLFEDLKVCVSNDYEMATPFAVPFGGFFSCQAGNPLAGLRQGQSPGLLQDFFYQEAPTNYPMKCPKGYSQHKAY… |
| A0A2C9KYS0 | 33-279 | TGQVQPEAGYLFGGLYLATQVNPVTGTKSCPPTFYAIRILSAMTVCISDDFQESSGMAVPFGGFFSCKAGNVLSAERLNSVGFHENL… |
| K1PMY6 | 1-197 | None |
| K1PZW3 | 146-376 | None |
| A0A3M0JAS4 | 225-438 | None |
| A0A814MAL9 | 151-379 | None |
| A0A1I8HAW6 | 120-407 | None |
| A0A2B4RKF9 | 218-456 | None |
| A0A183T541 | 207-454 | None |
| V3ZQY4 | 279-523 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.