DPCstruct | MC46349
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 115 ± 7 aa |
| Standard deviation of domain lengths | 7.10 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 93.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 47.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02769 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376TU02 | 39-160 | MSMKTRWQEGNEEREMTSPLSLVISAFARVEDVRHTITPQLSTEDNALLLIDLGKGNNALGATALAQVYRQLGDKPADVRDVAQLKG… |
| A0A855HM69 | 1-109 | MSGVITAFAPVSDVRKTLTPELRQIDGSVLVRIDLSKGQFRIGASILTQVYKAIGTITPDVDSFEDLKDFFNLIQDWNNRGLIQAYH… |
| A0A377AKY3 | 1-127 | None |
| A0A8B6ETX4 | 41-157 | None |
| A0A1E5W079 | 244-358 | None |
| A0A5P1F8N3 | 46-155 | None |
| T1HDB2 | 35-140 | None |
| A0A340X8E8 | 39-162 | None |
| A0A833KQ63 | 4-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.