DPCstruct | MC46348
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 171 ± 31 aa |
| Standard deviation of domain lengths | 30.52 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 33.81 |
| Pfam Score | 88.89 |
| Assigned Pfam label(s) | PF07670- PF07664 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A347W3Y8 | 591-779 | FLATFAKENIPNATLASLVGDGIIRGVGAPLSFLPLIATLFLGLTILEGSGYMARVAFLLDGIFVRFGLHGKSFIPLVMGFGCSVPA… |
| A0A7C1KQE8 | 63-223 | MSADNIFFELFLGKDAGLIQVGITYSIAIILPIVGFFFLSFGIMEDSGYLPRLAVMVNRIFKVIGLNGKAVLPMVMGLGCDTMATLT… |
| A0A0W1KKQ3 | 381-572 | None |
| A0A800BR02 | 1-140 | None |
| A0A1V5JV43 | 268-381 | None |
| A0A855HM48 | 259-428 | None |
| A0A0U3NQK7 | 304-542 | None |
| T0CQK4 | 99-245 | None |
| A0A117SU15 | 279-402 | None |
| A0A812NTX6 | 315-442 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.