DPCstruct | MC46345
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 89 ± 7 aa |
| Standard deviation of domain lengths | 6.85 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 44.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F1SNM2 | 13-99 | KIKVLKLSSNEKRIIYGEMVDQFDLDYSQELDKLKQDIEFALSVLRKLQPKLFSKKNVHVYEGGHHLDIINNGVGSLGWLIIEDHPI |
| A0A855HKQ7 | 3-80 | RLVFGKLVNVLDIDYSQDLSNLRKDIQLSLNALAESSFRHKLSFWTKEVYVHQGGHHIDVVDNGKGSLGWLIVEDHIT |
| A0A150HNR4 | 54-144 | None |
| A0A5N7WHH0 | 2-93 | None |
| A0A0E3CBY0 | 22-109 | None |
| A0A376BU79 | 1-84 | None |
| A0A4R0D8C6 | 1-105 | None |
| A0A433SHN2 | 138-226 | None |
| A0A378VGP3 | 26-119 | None |
| A0A1D3F4U0 | 1-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.