DPCstruct | MC46344
Metacluster Properties and Pfam Annotations
| Number of structural domains | 140 |
|---|---|
| Mean domain length (aa) | 110 ± 14 aa |
| Standard deviation of domain lengths | 13.61 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 16.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A855HKB8 | 16-122 | VPVETITSFKGFDKNLICRNFQYEMGKTYTHDGDVKACGSGFHACEYPLDVLGYYPPSQSRYAVVEQSGDLSREENGDTKVASRSIS… |
| A0A0K8QRR7 | 12-124 | SADEWCEYHGVKVSRGVATLYKAVNDEWTTSRGVDYSPGSKPACNDFSDTDACGGGLHFGPTPAHALSYFPEATKFVAVGVRVSELR… |
| A0A0F9GPX7 | 1-100 | None |
| A0A5P2ERG3 | 54-153 | None |
| A0A431ID13 | 12-112 | None |
| A0A388KMR2 | 178-294 | None |
| A0A5S5CQ68 | 245-355 | None |
| A0A0G1H4K9 | 1-100 | None |
| A0A0G4HWX9 | 101-226 | None |
| A0A3C1GCG9 | 55-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.