DPCstruct | MC46342
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 95 ± 22 aa |
| Standard deviation of domain lengths | 21.55 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 92.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 45.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0039 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A855HIH5 | 1-95 | VKPEAAQSWLPVNQYIGGVEHAILHLLYARFFHKLMRDEGVVQGNEPFTNLLTQGMVLADTFYREAENGKKTWFNPADILLEKDEKG… |
| A0A485IEB0 | 259-352 | ESSWYFARYACPQFEGGMLDRKAADYWLPVDQYIGGIEHAILHLLYARFFHKLMRDEGLVGSDEPFKNLLTQGMVVADTYYRTTANG… |
| X0QAY1 | 244-337 | None |
| A0A2B4R2S6 | 780-885 | None |
| A0A7C4AKH5 | 297-347 | None |
| A0A378FKZ4 | 80-146 | None |
| A0A2X1PQR8 | 20-114 | None |
| A0A5F4C0R4 | 626-739 | None |
| A0A378W2B9 | 27-140 | None |
| A0A7K3DI87 | 438-540 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.