DPCstruct | MC46340
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 111 ± 14 aa |
| Standard deviation of domain lengths | 14.49 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 22.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10411 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S1CBB5 | 15-99 | LSACSKPPAKELVQTAVKKFIPMDFEVLQVSEVKGIAGLYEAAINVGGHPVIFYVDKKCDYIFTGSMMSTQTKANLTNEAQKKFQ |
| A0A855HDQ2 | 6-96 | SALTLSLFSISLSHANIATVQQNLKKNFPDIPVQSVQTTPLKDIYEVYMGGQIVYTNDDANYFFIGNLIDNKNQKNLTEDSLQELEK… |
| A0A5C8KX84 | 111-206 | None |
| A0A2A2K4G3 | 964-1080 | None |
| A0A1C3HP03 | 1-95 | None |
| A0A1G1GMF1 | 16-145 | None |
| A0A1G0I527 | 28-128 | None |
| A0A495H3G1 | 2-131 | None |
| A0A7V0R0Z9 | 13-140 | None |
| A0A1W7QPL1 | 1-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.