DPCstruct | MC46335
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 162 ± 26 aa |
| Standard deviation of domain lengths | 26.05 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 37.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12269 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D4PGX7 | 29-165 | ESQTSFGSMYPTRIEGATRLFCDVYNPQSKTYCKRLQVLCPEHSRDPKVSADEVCGCPMVKDVFELTGDFCRVPKRKCNRHYCWEKL… |
| A0A821P672 | 2-115 | FCDYYNASNGTYCKRLRVMCPEHFKDPKVIDTDVCGCPLVKNVFDPTGEFCRAPKKSCLRHYQWEKLRRAEIDMERVRQWLRLDELV… |
| A0A674HFE4 | 4-112 | None |
| B4ILQ3 | 19-159 | None |
| A0A7J7YDC1 | 55-214 | None |
| A0A151I5A6 | 592-752 | None |
| A0A5K4F7L4 | 5-137 | None |
| A0A564YHV4 | 260-417 | None |
| A0A6L5CCD4 | 240-414 | None |
| A0A1D2NA81 | 191-374 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.