DPCstruct | MC46322
Metacluster Properties and Pfam Annotations
| Number of structural domains | 111 |
|---|---|
| Mean domain length (aa) | 137 ± 30 aa |
| Standard deviation of domain lengths | 29.60 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 81.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04430 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6F9CJV9 | 2-111 | SSPEIASLSWGHMKVKGCSSAYKDCKVWPGGSRAWDWRETGTDHHPGVQPADLEEVLQKGVEILVIGRGMSEALQRGVELRVLQTEK… |
| A0A7S2T019 | 46-192 | LRSGPPRRWINLGSEHYSDVLGGDGEAPAVLRGYTEDGFLLGDAAAPIKGALLCFERRCFVWDGVRGVDGIDRDKLAILRAVKPKPD… |
| A0A4Z0YDG5 | 198-369 | None |
| A0A6U3PGG2 | 11-134 | None |
| A0A672UVU3 | 153-316 | None |
| A0A819QTC6 | 862-1002 | None |
| A0A0V0QXQ2 | 98-240 | None |
| A0A819XUG7 | 59-204 | None |
| A0A4U0W7F8 | 8-157 | None |
| A0A0D2MD02 | 12-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.