DPCstruct | MC46321
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 103 ± 13 aa |
| Standard deviation of domain lengths | 13.40 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 32.05 |
| Pfam Score | 98.53 |
| Assigned Pfam label(s) | PF16029- PF12070 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B8MMZ0 | 7-125 | SSPSMARSVAVLAVALLLVACETAVPVEAKGKGSKGKRKTHLGGVDKEYYKLRDECTGGCTGGSDVQKENCVLLCVSPECYEKIYGS… |
| A0A176WAI5 | 3-74 | DRDLNRRKEACYVDIDNGLWGRGCRSSQIAKENCALRCVSGGCYNTVYGEDPLEEGEVDIRRGREFRNCLRK |
| A0A6P7F9N0 | 3-92 | None |
| A0A7S4C0L6 | 9-120 | None |
| A0A2H5NSQ7 | 738-819 | None |
| U5D2Q6 | 6-93 | None |
| A0A6G0XY29 | 34-148 | None |
| A0A5N6PWA3 | 6-86 | None |
| A0A5J4YK14 | 1-111 | None |
| A0A813PUG5 | 57-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.