DPCstruct | MC4632
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 240 ± 21 aa |
| Standard deviation of domain lengths | 20.59 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 27.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H6NA01 | 10-225 | MAFVYFDQCHCAYLLEKDLEEILYTLGLHLSRAQVKKLLNKVVLRESCFYRKLTDTSKDEENPEEIESSPEEIFGNRLLLPSPAIKQ… |
| A0A2C9KQE7 | 2-257 | KTVDPGLLLAFSYFDQNHCGYLTDKDTEDIIHTLGLKLSRAQIKKILQKIVQKESFKYRQLTDAEVDDNGVVIFKMDESENNQTNKP… |
| A0A6P6KVF6 | 472-676 | None |
| A0A0N0U5T9 | 785-1037 | None |
| A0A7J7U9Q7 | 158-380 | None |
| A0A834DU33 | 281-504 | None |
| A0A0D8XU01 | 1-259 | None |
| A0A6L5CC30 | 450-684 | None |
| A0A2J7RN41 | 279-547 | None |
| A0A0A9XJ01 | 47-306 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.