DPCstruct | MC46309
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 144 ± 14 aa |
| Standard deviation of domain lengths | 13.58 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 24.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F0JIV3 | 1-162 | MRDREPTTSEIIYYHVEHALGHFQILIQSIIGFASGAIRGATLLNGGAAVALLGFLASNFQLRNNELLPALQFFVAGALFASVTWVF… |
| A0A0K0SSJ4 | 1-160 | MKYNSETPPHIIKEYVKSNNERWDQLNNLILSVISDGVKFLFVINGGGCIAMLAFLGTSEELRKQQWTWSVLFVLFLGIVFIGFLNF… |
| A0A133S4T3 | 23-155 | None |
| A0A2E2KPK0 | 59-189 | None |
| A0A482IMK2 | 2-123 | None |
| A0A5E4SFY5 | 77-215 | None |
| A0A660URE8 | 2-139 | None |
| A0A2T7U822 | 38-201 | None |
| A0A1G2XDN2 | 1-142 | None |
| A0A7T9HEY3 | 1-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.