DPCstruct | MC46302
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 112 ± 7 aa |
| Standard deviation of domain lengths | 7.31 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 72.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 31.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06140 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W6YTX7 | 3-108 | PGNTLLSLIRVHPYQTIVYAVNGAILLEPRIFTVPTFWALGFEQRGPRKGSLAASTMSYFGYVPAGGVYALAQSAAMGGYGAGLAAG… |
| A0A0C4DQ88 | 174-281 | RRAWKRYRYLAGWAAKHRRRAAMVLLRLVVVLFPDFIARIILFPLGFGAAGIAAGSVAAWIQSLLGNVVRRSIFAYLQSAAMGGYGI… |
| A0A4S8XKB6 | 393-504 | None |
| A0A6A5W4N7 | 23-125 | None |
| A0A093ZXB8 | 310-417 | None |
| A0A3N4KC75 | 79-205 | None |
| E4V5D2 | 97-202 | None |
| A0A553HJF0 | 115-236 | None |
| A0A4S9KTC6 | 514-622 | None |
| A0A1V8STP5 | 2-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.