DPCstruct | MC46300
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 87 ± 6 aa |
| Standard deviation of domain lengths | 6.40 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 37.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A428K4K1 | 88-164 | YHPKISFKDFPADVFKGQLADPDFSTNPDVKSFITRIKNECANGINFAGHYTLVTWGCGSTCQSGVLVDRKTGKIFS |
| A0A533TCP2 | 259-343 | SKTSGSRYNVPQFTDYPSDAVYSGTNHPLFLDEFGKSYRTRLREAIKNGKPDFAGHYIVTKWGCGSSGCNTGAVIDAITGRAYLF |
| R9B0C4 | 1-91 | None |
| A0A1R3T8G5 | 422-509 | None |
| A0A7J7BFS6 | 344-433 | None |
| A0A4Q2U1Y8 | 12-92 | None |
| I3XBS2 | 68-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.