DPCstruct | MC463
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 121 ± 15 aa |
| Standard deviation of domain lengths | 14.92 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C6L7P3 | 27-155 | IAGGTTANIVSRLTGKPLIVDLDYHDPAIPPTGRIEGIDLVTEGVLTLNAAVEKLKNPAALAHNGQDGATRLAKLLLSCDKIDIFAG… |
| A0A3D5U7L2 | 3-119 | TPIKVNLKEIKSSSEVPPSAEMKGFDLVCEGTITLSRCLRALQEGQVPDKMPEDAVKRLITILLESDIIECVVGTKINDAHQDPALP… |
| A0A5Q4H0Q4 | 363-490 | None |
| A0A6I0E095 | 1-96 | None |
| A0A7C6TTG8 | 157-295 | None |
| A0A1M5BM30 | 104-240 | None |
| A0A7X8W4E3 | 1-102 | None |
| A0A7C6WBM4 | 16-107 | None |
| A0A352ZBB7 | 270-399 | None |
| A0A349JA13 | 441-570 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.