DPCstruct | MC46297
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 81 ± 10 aa |
| Standard deviation of domain lengths | 9.71 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 56.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1L640 | 11-87 | FSDIPTIEGLRLSYESCFTCGVSWYDHHISLDCAECGGYALQRPCPECGGKCSSYWTRNCAISHEKRRATWEGKCLC |
| A0A6G1S651 | 51-124 | HYLTIEDLKLTRNSCWLCGCNWLEDHVSLDCPECGGYALTRPCPSCDGKCNQTWTRNISATHDRHKALWIGQCN |
| A0A6I9VW53 | 99-175 | None |
| A0A182XZR7 | 42-115 | None |
| A0A6J2U5J8 | 2-77 | None |
| B7PBN7 | 67-142 | None |
| A0A6A4V9W0 | 250-331 | None |
| Q173L3 | 68-164 | None |
| A0A1J1IPH2 | 740-821 | None |
| A0A834IVL4 | 35-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.