DPCstruct | MC4629
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 138 ± 20 aa |
| Standard deviation of domain lengths | 20.33 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 44.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T7PXI5 | 21-146 | ATPLPVVSVDRLSRLETLTSALSRQLMLQQLYVEEKTRTEVDSGIKQVRLNRDGSKPYYTPTHTAGSVAAMHDHSDLIRTCGMGEFA… |
| A0A2C9KPC2 | 18-155 | RISVSQSDPQAEIKRLKNVISALGRQVMLQQFAQEEKLRSDGWSGLKQIRVDNDGPRNYHTNSHSGGSMGAIHDHSNNQITVGQGEG… |
| A0A1S3IS84 | 26-153 | None |
| A0A1S3IGS5 | 1-167 | None |
| A0A6S6SA08 | 111-248 | None |
| A0A7J7IVN8 | 3-119 | None |
| A0A7M5TXL9 | 139-303 | None |
| A0A5A8CH63 | 443-569 | None |
| A0A2C9KY79 | 2-122 | None |
| A0A2R2MJF5 | 1-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.