DPCstruct | MC46289
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 482 ± 79 aa |
| Standard deviation of domain lengths | 78.89 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 13.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1KVC0 | 12-539 | GNWLIKAKLVDRYIKSINGTIRGRIYFKIDDADVLSMFYTNKEQFNRLLVGETSCSLFSYSTSGWNLYLKALSNKGFLNHLLYVGPS… |
| A0A2C9M7M8 | 15-478 | SPPAGFYHWNDPGRLNISYKGRDTSRGINTTKWWTCEYDSYRYATAFTEWHLADITSFQLPYVSPQEDNPPVLPVSADITGVVKRFR… |
| T1KP36 | 37-595 | None |
| A0A183E0R2 | 3-374 | None |
| A0A7Y4T477 | 20-451 | None |
| A0A817C6T5 | 4-393 | None |
| A0A6L5CLN3 | 237-792 | None |
| A0A1V9ZVJ6 | 400-793 | None |
| A0A7M5X300 | 205-674 | None |
| T1KP30 | 12-514 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.