DPCstruct | MC46286
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 174 ± 34 aa |
| Standard deviation of domain lengths | 33.50 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 71.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0048 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7F6I4 | 115-243 | QRGDLSFIFNGDAAPSESFVVLDNEQKVYQRIHHEESEMETEEEVDILMSSDIYSATLSTKSISFTRAQTGWLFREDKTERVGNFLA… |
| T1KNL4 | 11-182 | VHQLERGDISFVFIGDAKPSHSLTVMDNKMKVYQRLRYEKFEVEIEDEVDILMSQDIVAAQMSTKSITFTRAQSGWLFREDKTEMVG… |
| A0A2Y9R7W0 | 169-352 | None |
| A0A183HMF5 | 3-169 | None |
| A0A4S4EX31 | 349-534 | None |
| A0A5F8AB58 | 327-536 | None |
| A0A0R3U5P2 | 39-143 | None |
| A0A4Y7IXD3 | 198-335 | None |
| A0A4Z2ER68 | 63-190 | None |
| A0A7R9FMX5 | 172-371 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.