DPCstruct | MC46284
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 454 ± 74 aa |
| Standard deviation of domain lengths | 73.57 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 29.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11573 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7WW29 | 10-414 | PRMVCESLINSDTLEWERTQLWALTFKLVRKIIGGVDYKGVRDLLKVILEKILTIPNTVSSAVVQQLLTAREVIAYILERNACLLPA… |
| T1KM15 | 32-436 | LRSVCEAILNCEHLHFNKQIFFCQSFELIHRVISQVDYKGVRDIIRFMIEKIHTIPIEANIAMLPQLDVMRKVLDYALNRNSSVLPA… |
| Q10669 | 17-607 | None |
| A0A1X7T1C2 | 2-384 | None |
| A0A7R9AQT1 | 2-484 | None |
| T1KIW4 | 13-415 | None |
| A0A158QUQ0 | 10-542 | None |
| A0A336LHK9 | 1-510 | None |
| A0A814SQC4 | 1-406 | None |
| H2YVM4 | 2-389 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.