DPCstruct | MC4628
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 131 ± 11 aa |
| Standard deviation of domain lengths | 10.55 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 35.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0039 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L8E1H4 | 492-622 | EKNYKFRLSAFQNDLKYWLKDENTVRPALYHKMLSQWVEEGTCLQDLSISRVRSKVPWAIPSPYDESQSIYVWMDALVNYLTALGYP… |
| A0A0G0C8W5 | 1-134 | MEKNYFFKLSKYQKDLIDLISKDKLKIYPIERKNEVLSFLKEPLQDISISRSNERAKNWGVPVPNDDSQKIYVWFDALNIYQSGIGF… |
| A0A1W0XEP9 | 165-297 | None |
| A0A842YGH3 | 2-105 | None |
| A0A645BVQ7 | 2-133 | None |
| A0A811LJH3 | 159-287 | None |
| A0A2T7FBY9 | 76-215 | None |
| A0A507ETL8 | 183-318 | None |
| I7I8R7 | 373-490 | None |
| A0A6L5DBM3 | 201-343 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.