DPCstruct | MC46275
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 180 ± 23 aa |
| Standard deviation of domain lengths | 23.40 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15002 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3FUI3 | 30-216 | LKIYKKMFEVKRREQLSALKNLVQLNDVHQQYKILDIMLKGLFKVLEDSRTVLIAADVLPDGPFPQDEKLKDAFSHVVENTAFFGDV… |
| R7VW24 | 27-185 | RVDSGLEIYKKLFEVKRKDQMNALKNLIELNDINQQYKIIDIMLKGLFKVLEDSRAVLIAADVPPDGPFPQDEKIKDAYSHVVENTA… |
| A0A7J7Z143 | 19-188 | None |
| A0A834UIN5 | 323-530 | None |
| A0A182U5W3 | 2-148 | None |
| A0A7M5XFL0 | 37-244 | None |
| A0A0M3ING2 | 153-337 | None |
| A0A5C6NR11 | 686-843 | None |
| H0ZHQ1 | 26-231 | None |
| A0A1B6L3M8 | 2-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.