DPCstruct | MC46271
Metacluster Properties and Pfam Annotations
| Number of structural domains | 81 |
|---|---|
| Mean domain length (aa) | 118 ± 18 aa |
| Standard deviation of domain lengths | 17.69 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 75.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 36.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3LW12 | 2-122 | LASFTREVIMRRPQDFKIACLRNVKHVFPVDHNPFYAGFGNRMTDVIAYQSVGVPEGRILTINPSGEVTGQTNSFGKTSYSSLSSLV… |
| A0A2P4WY94 | 330-463 | ASASRTHLENAMQQSIPLPPGVLITNSTGLTGALFTEVVNKTPHLFKIQVLNELQLTLIHAGRVVEHPVFVAGFGNRPTDIVAYEEV… |
| A0A7S3GJ52 | 114-240 | None |
| A0A7S1KU76 | 246-358 | None |
| C1E092 | 209-335 | None |
| R0MJ13 | 5-86 | None |
| A0A151HE13 | 141-288 | None |
| R1EJB0 | 259-381 | None |
| F4Q1P5 | 101-216 | None |
| A0A0V0QJG0 | 1085-1199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.