DPCstruct | MC46270
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 79 ± 15 aa |
| Standard deviation of domain lengths | 14.87 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 79.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 35.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0391 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3GM70 | 19-97 | QRSDSPTVVKREMEEPVKKFDRSHYMFTDRQNETLVKYPGDLNGQQFMINKCENCDIWILDNTATVSIDKTTNCRIYLG |
| A0A4S2L6H8 | 33-102 | WRDNGQLDPNDFKISDKTEGVWGRVPGEIGGQQFLIQDCKNASIYLLDHINTITIDDCDNCTILTGPIRT |
| A0A397F1Q1 | 42-115 | None |
| A0A2P8YDH2 | 1-92 | None |
| A0A819ICU8 | 9-86 | None |
| A0A1A8HR18 | 1-114 | None |
| A0A7I8VYB9 | 1-92 | None |
| A0A6A0A448 | 1-63 | None |
| A0A6L5CS29 | 6-76 | None |
| A0A0W8C9W0 | 31-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.