DPCstruct | MC46269
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 160 ± 20 aa |
| Standard deviation of domain lengths | 19.50 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 66.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05786 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8HGJ5 | 1-122 | MASAGEGPTALTLTRRLSARQLSEYENCMRLSAEGKISAKNAFALNLIDYLEGLVKGDCEFSNFQLASSSLDAGAKIYAGRVDAVHR… |
| A0A803QJQ3 | 340-496 | QSPTSPFFLGSNDDKLERAQARAARAAAIRRKNISVSALPSLGDSDPLLGKQQIFELFQNCIKLASENKINQKNTWELNLIDHLTEI… |
| F4PZI6 | 100-248 | None |
| M7XAQ1 | 1-185 | None |
| X6MJN6 | 1-173 | None |
| A0A4Z2BEB3 | 24-188 | None |
| A0A0R3UGI6 | 32-197 | None |
| V5T9C5 | 1-135 | None |
| A0A2K3N6Q3 | 1-178 | None |
| L8GII0 | 33-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.