DPCstruct | MC46263
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 375 ± 63 aa |
| Standard deviation of domain lengths | 62.85 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 75.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 19.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8FNA4 | 32-450 | SQGALPFVLQRCLPEPVPESGPALRMEDVLPVGELAFVAKGNWYGMSGPVLGFKQTKVRLQLRVSAQPDLSVVDSEDCFLLLRHLVS… |
| A0A4P9YVJ4 | 2-227 | RFVPSYVAAKRVQMSPLLLSKITSTLHVAMGNNEDERVNLGLSIKFSGKNQKVHGYSRKTVRGWDFSEKAIQLIQEYKDRFPDFIAM… |
| A0A1R1XHG3 | 556-1096 | None |
| A0A3N4LYQ0 | 72-484 | None |
| D3BCJ3 | 304-683 | None |
| Q75JF5 | 843-1285 | None |
| A0A368FT89 | 125-579 | None |
| A0A7S1FGU1 | 266-654 | None |
| A0A2G8LDI3 | 167-624 | None |
| K3W9G5 | 667-1023 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.